PDB entry 1al7

View 1al7 on RCSB PDB site
Description: three-dimensional structures of glycolate oxidase with bound active-site inhibitors
Class: flavoprotein
Keywords: flavoprotein, drug design, inhibitor binding
Deposited on 1997-06-12, released 1997-11-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.18
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycolate oxidase
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1al7a_
  • Heterogens: FMN, HST, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1al7A (A:)
    meitnvneyeaiakqklpkmvydyyasgaedqwtlaenrnafsrilfrprilidvtnidm
    tttilgfkismpimiaptamqkmahpegeyataraasaagtimtlsswatssveevastg
    pgirffqlyvykdrnvvaqlvrraeragfkaialtvdtprlgrreadiknrfvlppfltl
    knfegidlgkmdkandsglssyvagqidrslswkdvawlqtitslpilvkgvitaedarl
    avqhgaagiivsnhgarqldyvpatimaleevvkaaqgripvfldggvrrgtdvfkalal
    gaagvfigrpvvfslaaegeagvkkvlqmmrdefeltmalsgcrslkeisrshiaadwd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1al7A (A:)
    meitnvneyeaiakqklpkmvydyyasgaedqwtlaenrnafsrilfrprilidvtnidm
    tttilgfkismpimiaptamqkmahpegeyataraasaagtimtlsswatssveevastg
    pgirffqlyvykdrnvvaqlvrraeragfkaialtvdtprlgrreadiknrfvlppfltl
    knfegidlglssyvagqidrslswkdvawlqtitslpilvkgvitaedarlavqhgaagi
    ivsnhgarqldyvpatimaleevvkaaqgripvfldggvrrgtdvfkalalgaagvfigr
    pvvfslaaegeagvkkvlqmmrdefeltmalsgcrslkeisrshiaadwd