PDB entry 1al6

View 1al6 on RCSB PDB site
Description: chicken citrate synthase complex with n-hydroxyamido-coa and oxaloacetate
Class: lyase
Keywords: oxo-acid-lyase, lyase
Deposited on 1997-06-12, released 1997-12-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: citrate synthase
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23007 (Start-432)
      • conflict (11)
      • conflict (29)
      • conflict (32)
      • conflict (51)
      • insertion (80)
      • conflict (84)
      • conflict (103-104)
      • conflict (109)
      • conflict (162)
      • conflict (169)
      • conflict (173)
      • conflict (221)
      • conflict (282)
      • conflict (285)
      • conflict (290-291)
      • insertion (297-299)
      • conflict (342)
      • conflict (365)
      • conflict (367)
      • conflict (427)
      • conflict (430-431)
    Domains in SCOPe 2.07: d1al6a_
  • Heterogens: OAA, HAX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1al6A (A:)
    asstnlkdvlaslipkeqariktfrqqhgntavgqitvdmsyggmrgmkgliyetsvldp
    degirfrgfsipecqkllpkagggeeplpeglfwllvtgqiptpeqvswvskewakraal
    pshvvtmldnfptnlhpmsqlsaaitalnsesnfarayaeginrtkywefvyedamdlia
    klpcvaakiyrnlyragssigaidskldwshnftnmlgytdpqftelmrlyltihsdheg
    gnvsahtshlvgsalsdpylsfaaamnglagplhglanqevllwlsqlqkdlgadasdek
    lrdyiwntlnsgrvvpgyghavlrktdprytcqrefalkhlpsdpmfklvaqlykivpnv
    lleqgkaknpwpnvdahsgvllqyygmtemnyytvlfgvsralgvlaqliwsralgfple
    rpksmstagleklsagg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1al6A (A:)
    stnlkdvlaslipkeqariktfrqqhgntavgqitvdmsyggmrgmkgliyetsvldpde
    girfrgfsipecqkllpkagggeeplpeglfwllvtgqiptpeqvswvskewakraalps
    hvvtmldnfptnlhpmsqlsaaitalnsesnfarayaeginrtkywefvyedamdliakl
    pcvaakiyrnlyragssigaidskldwshnftnmlgytdpqftelmrlyltihsdheggn
    vsahtshlvgsalsdpylsfaaamnglagplhglanqevllwlsqlqkdlgadasdeklr
    dyiwntlnsgrvvpgyghavlrktdprytcqrefalkhlpsdpmfklvaqlykivpnvll
    eqgkaknpwpnvdahsgvllqyygmtemnyytvlfgvsralgvlaqliwsralgfplerp
    ksmstagleklsagg