PDB entry 1al0

View 1al0 on RCSB PDB site
Description: procapsid of bacteriophage phix174
Deposited on 1997-06-06, released 1998-01-28
The last revision prior to the SCOP 1.55 freeze date was dated 1998-01-28, with a file datestamp of 1998-01-28.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.316
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Domains in SCOP 1.55: d1al01_
  • Chain '2':
    Domains in SCOP 1.55: d1al02_
  • Chain '3':
    Domains in SCOP 1.55: d1al03_
  • Chain '4':
    Domains in SCOP 1.55: d1al04_
  • Chain 'F':
    Domains in SCOP 1.55: d1al0f_
  • Chain 'G':
    Domains in SCOP 1.55: d1al0g_

PDB Chain Sequences:

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1al01 (1:)
    eqsvrfqtalasikliqasavldlteddfdfltsnkvwiatdrsrarrcveacvygtldf
    vgyprfpapvefiaaviayyvhpvniqtaclimegaefteniingverpvkaaelfaftl
    rvragntdvltdaeenvrqklra
    

  • Chain '2':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1al02 (2:)
    eqsvrfqtalasikliqasavldlteddfdfltsnkvwiatdrsrarrcveacvygtldf
    vgyprfpapvefiaaviayyvhpvniqtaclimegaefteniingverpvkaaelfaftl
    rvragntdvltda
    

  • Chain '3':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1al03 (3:)
    teqsvrfqtalasikliqasavldlteddfdfltsnkvwiatdrsrarrcveacvygtld
    fvgyprfpapvefiaaviayyvhpvniqtaclimegaefteniingverpvkaaelfaft
    lrvragntdvltdaeenvrq
    

  • Chain '4':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1al04 (4:)
    qsvrfqtalasikliqasavldlteddfdfltsnkvwiatdrsrarrcveacvygtldfv
    gyprfpapvefiaaviayyvhpvniqtaclimegaefteniingverpvkaaelfaftlr
    vragntdvltdaeenvrqklraegvm
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1al0F (F:)
    qtgaermphdlshlgflagqigrlitisttpviagdsfemdavgalrlsplrrglaidst
    vdiftfyvphrhvygeqwikfmkdgvnatplptvnttgyidhaaflgtinpdtnkipkhl
    fqgylniynnyfkapwmpdrteanpnelnqddarygfrcchlkniwtaplppetelsrqm
    ttsttsidimglqaayanlhtdqerdyfmqryrdvissfggktsydadnrpllvmrsnlw
    asgydvdgtdqtslgqfsgrvqqtykhsvprffvpehgtmftlalvrfpptatkeiqyln
    akgaltytdiagdpvlygnlppreismkdvfrsgdsskkfkiaegqwyryapsyvspayh
    llegfpfiqeppsgdlqervlirhhdydqcfqsvqllqwnsqvkfnvtvyrnlpttrd
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1al0G (G:)
    mfqtfisrhnsnffsdklvltsvtpassapvlqtpkatsstlyfdsltvnagnggflhci
    qmdtsvnaanqvvsvgadiafdadpkffaclvrfesssvpttlptaydvyplngrhdggy
    ytvkdcvtidvlprtpgnnvyvgfmvwsnftatkcrglvslnqvikeiiclqplk