PDB entry 1al0

View 1al0 on RCSB PDB site
Description: procapsid of bacteriophage phix174
Class: Virus
Keywords: COMPLEX (VIRUS CAPSID PROTEINS), BACTERIOPHAGE, PROCAPSID, SCAFFOLDING PROTEIN, CHAPERONE, Icosahedral virus
Deposited on 1997-06-06, released 1998-01-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-07.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.316
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: scaffolding protein gpd
    Species: Enterobacteria phage phiX174 [TaxId:10847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1al01_
  • Chain '2':
    Compound: scaffolding protein gpd
    Species: Enterobacteria phage phiX174 [TaxId:10847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1al02_
  • Chain '3':
    Compound: scaffolding protein gpd
    Species: Enterobacteria phage phiX174 [TaxId:10847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1al03_
  • Chain '4':
    Compound: scaffolding protein gpd
    Species: Enterobacteria phage phiX174 [TaxId:10847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1al04_
  • Chain 'B':
    Compound: scaffolding protein gpb
    Species: Enterobacteria phage phiX174 [TaxId:10847]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: capsid protein gpf
    Species: Enterobacteria phage phiX174 [TaxId:10847]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03641
      • conflict (215)
    Domains in SCOPe 2.07: d1al0f_
  • Chain 'G':
    Compound: spike protein gpg
    Species: Enterobacteria phage phiX174 [TaxId:10847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1al0g_

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >1al01 (1:)
    msqvteqsvrfqtalasikliqasavldlteddfdfltsnkvwiatdrsrarrcveacvy
    gtldfvgyprfpapvefiaaviayyvhpvniqtaclimegaefteniingverpvkaael
    faftlrvragntdvltdaeenvrqklraegvm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1al01 (1:)
    eqsvrfqtalasikliqasavldlteddfdfltsnkvwiatdrsrarrcveacvygtldf
    vgyprfpapvefiaaviayyvhpvniqtaclimegaefteniingverpvkaaelfaftl
    rvragntdvltdaeenvrqklra
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >1al02 (2:)
    msqvteqsvrfqtalasikliqasavldlteddfdfltsnkvwiatdrsrarrcveacvy
    gtldfvgyprfpapvefiaaviayyvhpvniqtaclimegaefteniingverpvkaael
    faftlrvragntdvltdaeenvrqklraegvm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1al02 (2:)
    eqsvrfqtalasikliqasavldlteddfdfltsnkvwiatdrsrarrcveacvygtldf
    vgyprfpapvefiaaviayyvhpvniqtaclimegaefteniingverpvkaaelfaftl
    rvragntdvltda
    

  • Chain '3':
    Sequence, based on SEQRES records: (download)
    >1al03 (3:)
    msqvteqsvrfqtalasikliqasavldlteddfdfltsnkvwiatdrsrarrcveacvy
    gtldfvgyprfpapvefiaaviayyvhpvniqtaclimegaefteniingverpvkaael
    faftlrvragntdvltdaeenvrqklraegvm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1al03 (3:)
    teqsvrfqtalasikliqasavldlteddfdfltsnkvwiatdrsrarrcveacvygtld
    fvgyprfpapvefiaaviayyvhpvniqtaclimegaefteniingverpvkaaelfaft
    lrvragntdvltdaeenvrq
    

  • Chain '4':
    Sequence, based on SEQRES records: (download)
    >1al04 (4:)
    msqvteqsvrfqtalasikliqasavldlteddfdfltsnkvwiatdrsrarrcveacvy
    gtldfvgyprfpapvefiaaviayyvhpvniqtaclimegaefteniingverpvkaael
    faftlrvragntdvltdaeenvrqklraegvm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1al04 (4:)
    qsvrfqtalasikliqasavldlteddfdfltsnkvwiatdrsrarrcveacvygtldfv
    gyprfpapvefiaaviayyvhpvniqtaclimegaefteniingverpvkaaelfaftlr
    vragntdvltdaeenvrqklraegvm
    

  • Chain 'B':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1al0F (F:)
    sniqtgaermphdlshlgflagqigrlitisttpviagdsfemdavgalrlsplrrglai
    dstvdiftfyvphrhvygeqwikfmkdgvnatplptvnttgyidhaaflgtinpdtnkip
    khlfqgylniynnyfkapwmpdrteanpnelnqddarygfrcchlkniwtaplppetels
    rqmttsttsidimglqaayanlhtdqerdyfmqryrdvissfggktsydadnrpllvmrs
    nlwasgydvdgtdqtslgqfsgrvqqtykhsvprffvpehgtmftlalvrfpptatkeiq
    ylnakgaltytdiagdpvlygnlppreismkdvfrsgdsskkfkiaegqwyryapsyvsp
    ayhllegfpfiqeppsgdlqervlirhhdydqcfqsvqllqwnsqvkfnvtvyrnlpttr
    dsimts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1al0F (F:)
    qtgaermphdlshlgflagqigrlitisttpviagdsfemdavgalrlsplrrglaidst
    vdiftfyvphrhvygeqwikfmkdgvnatplptvnttgyidhaaflgtinpdtnkipkhl
    fqgylniynnyfkapwmpdrteanpnelnqddarygfrcchlkniwtaplppetelsrqm
    ttsttsidimglqaayanlhtdqerdyfmqryrdvissfggktsydadnrpllvmrsnlw
    asgydvdgtdqtslgqfsgrvqqtykhsvprffvpehgtmftlalvrfpptatkeiqyln
    akgaltytdiagdpvlygnlppreismkdvfrsgdsskkfkiaegqwyryapsyvspayh
    llegfpfiqeppsgdlqervlirhhdydqcfqsvqllqwnsqvkfnvtvyrnlpttrd
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1al0G (G:)
    mfqtfisrhnsnffsdklvltsvtpassapvlqtpkatsstlyfdsltvnagnggflhci
    qmdtsvnaanqvvsvgadiafdadpkffaclvrfesssvpttlptaydvyplngrhdggy
    ytvkdcvtidvlprtpgnnvyvgfmvwsnftatkcrglvslnqvikeiiclqplk