PDB entry 1akz

View 1akz on RCSB PDB site
Description: human uracil-DNA glycosylase
Class: glycosidase
Keywords: glycosylase, DNA repair, uracil removal from DNA, alpha/ beta protein, glycosidase
Deposited on 1997-05-27, released 1997-08-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-03-30, with a file datestamp of 2011-03-25.
Experiment type: XRAY
Resolution: 1.57 Å
R-factor: 0.189
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uracil-DNA glycosylase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1akza1, d1akza2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1akzA (A:)
    meffgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvi
    lgqdpyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvl
    llnavltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrh
    hvlqtahpsplsvyrgffgcrhfsktnellqksgkkpidwkel