PDB entry 1akw

View 1akw on RCSB PDB site
Description: g61l oxidized flavodoxin mutant
Class: electron transport
Keywords: electron transport, electron transfer, flavoprotein, fmn, flavodoxin, mutant
Deposited on 1997-05-27, released 1998-05-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.182
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flavodoxin
    Species: Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough [TaxId:882]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00323 (0-146)
      • engineered (59)
    Domains in SCOPe 2.08: d1akwa_
  • Heterogens: FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1akwA (A:)
    pkalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwl
    ddsielqddfiplfdsleetgaqgrkvacfgcgdssyeyfcgavdaieeklknlgaeivq
    dglridgdpraarddivgwahdvrgai