PDB entry 1akv

View 1akv on RCSB PDB site
Description: d95a semiquinone flavodoxin mutant from d. vulgaris
Deposited on 1997-05-27, released 1998-12-02
The last revision prior to the SCOP 1.59 freeze date was dated 1998-12-02, with a file datestamp of 1998-12-02.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.2
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1akv__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1akv_ (-)
    pkalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwg
    ddsielqddfiplfdsleetgaqgrkvacfgcgassyeyfcgavdaieeklknlgaeivq
    dglridgdpraarddivgwahdvrgai