PDB entry 1aku

View 1aku on RCSB PDB site
Description: d95a hydroquinone flavodoxin mutant from d. vulgaris
Class: electron transport
Keywords: electron transport, electron transfer, flavoprotein, fmn, flavodoxin, mutant
Deposited on 1997-05-27, released 1998-12-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.215
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flavodoxin
    Species: Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough [TaxId:882]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00323 (0-146)
      • engineered (93)
    Domains in SCOPe 2.07: d1akua_
  • Heterogens: SO4, FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1akuA (A:)
    pkalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwg
    ddsielqddfiplfdsleetgaqgrkvacfgcgassyeyfcgavdaieeklknlgaeivq
    dglridgdpraarddivgwahdvrgai