PDB entry 1aks

View 1aks on RCSB PDB site
Description: crystal structure of the first active autolysate form of the porcine alpha trypsin
Class: serine protease
Keywords: hydrolase, serine protease
Deposited on 1996-07-24, released 1997-02-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.2
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha trypsin
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1aks.1
  • Chain 'B':
    Compound: alpha trypsin
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00761 (0-97)
      • conflict (19)
      • conflict (41)
    Domains in SCOPe 2.05: d1aks.1
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aksA (A:)
    ivggytcaansipyqvslnsgshfcggslinsqwvvsaahcyksriqvrlgehnidvleg
    neqfinaakiithpnfngntldndimliklsspatlnsrvatvslprscaaagteclisg
    wgntk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aksB (B:)
    ssgssypsllqclkapvlsnssckssypgqitgnmicvgflqggkdscqgdsggpvvcng
    qlqgivswgygcaqknkpgvytkvcnyvnwiqqtiaan