PDB entry 1aks

View 1aks on RCSB PDB site
Description: crystal structure of the first active autolysate form of the porcine alpha trypsin
Deposited on 1996-07-24, released 1997-02-12
The last revision prior to the SCOP 1.61 freeze date was dated 1997-02-12, with a file datestamp of 1997-02-13.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.2
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1aks.1
  • Chain 'B':
    Domains in SCOP 1.61: d1aks.1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1aksA (A:)
ivggytcaansipyqvslnsgshfcggslinsqwvvsaahcyksriqvrlgehnidvleg
neqfinaakiithpnfngntldndimliklsspatlnsrvatvslprscaaagteclisg
wgntk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1aksB (B:)
ssgssypsllqclkapvlsnssckssypgqitgnmicvgflqggkdscqgdsggpvvcng
qlqgivswgygcaqknkpgvytkvcnyvnwiqqtiaan