PDB entry 1akp

View 1akp on RCSB PDB site
Description: sequential 1h,13c and 15n nmr assignments and solution conformation of apokedarcidin
Class: antibiotic chromoprotein
Keywords: antibiotic chromoprotein
Deposited on 1994-06-20, released 1994-08-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: apokedarcidin
  Species: actinomycete ATCC 53650 [TaxId:38989]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P41249 (0-113)
  Domains in SCOPe 2.08: d1akpa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1akpA (A:)
  asaavsvspatgladgatvtvsasgfatstsatalqcailadgrgacnvaefhdfslsgg
  egttsvvvrrsftgyvmpdgpevgavdcdtapggceivvggntgeygnaaisfg