PDB entry 1ako

View 1ako on RCSB PDB site
Description: exonuclease iii from escherichia coli
Deposited on 1997-05-26, released 1997-08-20
The last revision prior to the SCOP 1.57 freeze date was dated 1997-08-20, with a file datestamp of 1997-08-20.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.169
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1ako__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ako_ (-)
    mkfvsfninglrarphqleaivekhqpdviglqetkvhddmfpleevaklgynvfyhgqk
    ghygvalltketpiavrrgfpgddeeaqrriimaeipsllgnvtvingyfpqgesrdhpi
    kfpakaqfyqnlqnyletelkrdnpvlimgdmnisptdldigigeenrkrwlrtgkcsfl
    peerewmdrlmswglvdtfrhanpqtadrfswfdyrskgfddnrglridlllasqplaec
    cvetgidyeirsmekpsdhapvwatfrr