PDB entry 1ako

View 1ako on RCSB PDB site
Description: exonuclease III from escherichia coli
Class: nuclease
Keywords: nuclease, exonuclease, ap-endonuclease, DNA repair
Deposited on 1997-05-26, released 1997-08-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.169
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: exonuclease III
    Species: Escherichia coli [TaxId:83333]
    Gene: XTH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1akoa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1akoA (A:)
    mkfvsfninglrarphqleaivekhqpdviglqetkvhddmfpleevaklgynvfyhgqk
    ghygvalltketpiavrrgfpgddeeaqrriimaeipsllgnvtvingyfpqgesrdhpi
    kfpakaqfyqnlqnyletelkrdnpvlimgdmnisptdldigigeenrkrwlrtgkcsfl
    peerewmdrlmswglvdtfrhanpqtadrfswfdyrskgfddnrglridlllasqplaec
    cvetgidyeirsmekpsdhapvwatfrr