PDB entry 1akn

View 1akn on RCSB PDB site
Description: structure of bile-salt activated lipase
Class: hydrolase()
Keywords: hydrolase, serine esterase, lipid degradation, glycoprotein, carboxylic esterase, hydrolase()
Deposited on 1997-05-23, released 1998-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.211
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bile-salt activated lipase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1akna_
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1aknA (A:)
    aklgsvyteggfvegvnkklslfgdsidifkgipfaaapkalekperhpgwqgtlkaksf
    kkrclqatltqdstygnedclylniwvpqgrkevshdlpvmiwiyggaflmgasqganfl
    snylydgeeiatrgnvivvtfnyrvgplgflstgdsnlpgnyglwdqhmaiawvkrniea
    fggdpdnitlfgesaggasvslqtlspynkglikraisqsgvglcpwaiqqdplfwakri
    aekvgcpvddtskmagclkitdpraltlayklplgsteypklhylsfvpvidgdfipddp
    vnlyanaadvdyiagtndmdghlfvgmdvpainsnkqdvteedfyklvsgltvtkglrga
    natyevytepwaqdssqetrkktmvdletdilfliptkiavaqhkshaksantytylfsq
    psrmpiypkwmgadhaddlqyvfgkpfatplgyraqdrtvskamiaywtnfartgdpntg
    hstvpanwdpytleddnyleinkqmdsnsmklhlrtnylqfwtqtyqalptvtsagasll
    ppednsqaspvppadnsgaptepsagdsevaqmpvvigf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aknA (A:)
    aklgsvyteggfvegvnkklslfgdsidifkgipfaaapkalekperhpgwqgtlkaksf
    kkrclqatltqdstygnedclylniwvpqgrkevshdlpvmiwiyggaflmgasqganfl
    snylydgeeiatrgnvivvtfnyrvgplgflstgdsnlpgnyglwdqhmaiawvkrniea
    fggdpdnitlfgesaggasvslqtlspynkglikraisqsgvglcpwaiqqdplfwakri
    aekvgcpvddtskmagclkitdpraltlayklplgsteypklhylsfvpvidgdfipddp
    vnlyanaadvdyiagtndmdghlfvgmdvpainsnkqdvteedfyklvsgltvtkglrga
    natyevytepwaqdssqetrkktmvdletdilfliptkiavaqhkshaksantytylfsq
    psrmpiypkwmgadhaddlqyvfgkpfatplgyraqdrtvskamiaywtnfartgdpntg
    hstvpanwdpytleddnyleinkqmdsnsmklhlrtnylqfwtqtyqalptvtsagasll
    ppednsq