PDB entry 1akm

View 1akm on RCSB PDB site
Description: ornithine transcarbamylase from escherichia coli
Class: transferase
Keywords: transferase, anabolic, urea cycle, carbamyl phosphate
Deposited on 1997-05-23, released 1998-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.229
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ornithine transcarbamylase
    Species: Escherichia coli [TaxId:562]
    Gene: ARGI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1akma1, d1akma2
  • Chain 'B':
    Compound: ornithine transcarbamylase
    Species: Escherichia coli [TaxId:562]
    Gene: ARGI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1akmb1, d1akmb2
  • Chain 'C':
    Compound: ornithine transcarbamylase
    Species: Escherichia coli [TaxId:562]
    Gene: ARGI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1akmc1, d1akmc2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1akmA (A:)
    sgfyhkhflklldftpaelnsllqlaaklkadkksgkeeakltgknialifekdstrtrc
    sfevaaydqgarvtylgpsgsqighkesikdtarvlgrmydgiqyrgygqeivetlaeya
    svpvwngltnefhptqlladlltmqehlpgkafnemtlvyagdarnnmgnsmleaaaltg
    ldlrlvapqacwpeaalvtecralaqqnggnitltedvakgvegadfiytdvwvsmgeak
    ekwaeriallreyqvnskmmqltgnpevkflhclpafhddqttlgkkmaeefglhggmev
    tdevfesaasivfdqaenrmhtikavmvatlsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1akmA (A:)
    sgfyhkhflklldftpaelnsllqlaaklkadkksgkeeakltgknialifekdstrtrc
    sfevaaydqgarvtylgpsgsqighkesikdtarvlgrmydgiqyrgygqeivetlaeya
    svpvwngltnefhptqlladlltmqehlpgkafnemtlvyagdarnnmgnsmleaaaltg
    ldlrlvapqacwpeaalvtecralaqqnggnitltedvakgvegadfiytdvwvriallr
    eyqvnskmmqltgnpevkflhclpafhddqttlgkkmaeefglhggmevtdevfesaasi
    vfdqaenrmhtikavmvatlsk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1akmB (B:)
    sgfyhkhflklldftpaelnsllqlaaklkadkksgkeeakltgknialifekdstrtrc
    sfevaaydqgarvtylgpsgsqighkesikdtarvlgrmydgiqyrgygqeivetlaeya
    svpvwngltnefhptqlladlltmqehlpgkafnemtlvyagdarnnmgnsmleaaaltg
    ldlrlvapqacwpeaalvtecralaqqnggnitltedvakgvegadfiytdvwvsmgeak
    ekwaeriallreyqvnskmmqltgnpevkflhclpafhddqttlgkkmaeefglhggmev
    tdevfesaasivfdqaenrmhtikavmvatlsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1akmB (B:)
    sgfyhkhflklldftpaelnsllqlaaklkadkksgkeeakltgknialifekdstrtrc
    sfevaaydqgarvtylgpsgsqighkesikdtarvlgrmydgiqyrgygqeivetlaeya
    svpvwngltnefhptqlladlltmqehlpgkafnemtlvyagdarnnmgnsmleaaaltg
    ldlrlvapqacwpeaalvtecralaqqnggnitltedvakgvegadfiytdvwvriallr
    eyqvnskmmqltgnpevkflhclpafhddqttlgkkmaeefglhggmevtdevfesaasi
    vfdqaenrmhtikavmvatlsk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1akmC (C:)
    sgfyhkhflklldftpaelnsllqlaaklkadkksgkeeakltgknialifekdstrtrc
    sfevaaydqgarvtylgpsgsqighkesikdtarvlgrmydgiqyrgygqeivetlaeya
    svpvwngltnefhptqlladlltmqehlpgkafnemtlvyagdarnnmgnsmleaaaltg
    ldlrlvapqacwpeaalvtecralaqqnggnitltedvakgvegadfiytdvwvsmgeak
    ekwaeriallreyqvnskmmqltgnpevkflhclpafhddqttlgkkmaeefglhggmev
    tdevfesaasivfdqaenrmhtikavmvatlsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1akmC (C:)
    sgfyhkhflklldftpaelnsllqlaaklkadkksgkeeakltgknialifekdstrtrc
    sfevaaydqgarvtylgpsgsqighkesikdtarvlgrmydgiqyrgygqeivetlaeya
    svpvwngltnefhptqlladlltmqehlpgkafnemtlvyagdarnnmgnsmleaaaltg
    ldlrlvapqacwpeaalvtecralaqqnggnitltedvakgvegadfiytdvwvriallr
    eyqvnskmmqltgnpevkflhclpafhddqttlgkkmaeefglhggmevtdevfesaasi
    vfdqaenrmhtikavmvatlsk