PDB entry 1akh

View 1akh on RCSB PDB site
Description: mat a1/alpha2/dna ternary complex
Deposited on 1997-05-19, released 1998-05-20
The last revision prior to the SCOP 1.57 freeze date was dated 1999-02-02, with a file datestamp of 1999-02-02.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.201
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1akha_
  • Chain 'B':
    Domains in SCOP 1.57: d1akhb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1akhA (A:)
    ispqarafleevfrrkqslnskekeevakkcgitplqvrvwfinkrmrs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1akhB (B:)
    tkpyrghrftkenvrileswfaknienpyldtkglenlmkntslsriqiknwvsnrrrke
    ktitiapeladllsgepl