PDB entry 1ake

View 1ake on RCSB PDB site
Description: structure of the complex between adenylate kinase from escherichia coli and the inhibitor ap5a refined at 1.9 angstroms resolution: a model for a catalytic transition state
Class: transferase(phosphotransferase)
Keywords: transferase(phosphotransferase)
Deposited on 1991-11-08, released 1994-01-31
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.196
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenylate kinase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1akea1, d1akea2
  • Chain 'B':
    Compound: adenylate kinase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1akeb1, d1akeb2
  • Heterogens: AP5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1akeA (A:)
    mriillgapgagkgtqaqfimekygipqistgdmlraavksgselgkqakdimdagklvt
    delvialvkeriaqedcrngflldgfprtipqadamkeaginvdyvlefdvpdelivdri
    vgrrvhapsgrvyhvkfnppkvegkddvtgeelttrkddqeetvrkrlveyhqmtaplig
    yyskeaeagntkyakvdgtkpvaevradlekilg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1akeB (B:)
    mriillgapgagkgtqaqfimekygipqistgdmlraavksgselgkqakdimdagklvt
    delvialvkeriaqedcrngflldgfprtipqadamkeaginvdyvlefdvpdelivdri
    vgrrvhapsgrvyhvkfnppkvegkddvtgeelttrkddqeetvrkrlveyhqmtaplig
    yyskeaeagntkyakvdgtkpvaevradlekilg