PDB entry 1aka

View 1aka on RCSB PDB site
Description: structural basis for the catalytic activity of aspartate aminotransferase k258h lacking its pyridoxal-5'-phosphate-binding lysine residue
Class: transferase(aminotransferase)
Keywords: transferase(aminotransferase)
Deposited on 1994-02-28, released 1994-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartate aminotransferase
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00508 (0-400)
      • conflict (44)
      • engineered mutation (249)
    Domains in SCOPe 2.07: d1akaa_
  • Chain 'B':
    Compound: aspartate aminotransferase
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00508 (0-400)
      • conflict (44)
      • engineered mutation (249)
    Domains in SCOPe 2.07: d1akab_
  • Heterogens: PLP, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1akaA (A:)
    sswwshvemgppdpilgvteafkrdtnskkmnlgvgayrddngkpyvlncvrkaeamiaa
    kkmdkeylpiagladftrasaelalgenseafksgryvtvqgisgtgslrvganflqrff
    kfsrdvylpkpswgnhtpifrdaglqlqayryydpktcsldftgamediskipeksiill
    hacahnptgvdprqeqwkelasvvkkrnllayfdmayqgfasgdinrdawalrhfieqgi
    dvvlsqsyahnmglygeragaftvicrdaeeakrvesqlkilirpmysnppmngariasl
    ilntpelrkewlvevkgmadriismrtqlvsnlkkegsshnwqhitdqigmfcftglkpe
    qverltkefsiymtkdgrisvagvassnvgylahaihqvtk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1akaB (B:)
    sswwshvemgppdpilgvteafkrdtnskkmnlgvgayrddngkpyvlncvrkaeamiaa
    kkmdkeylpiagladftrasaelalgenseafksgryvtvqgisgtgslrvganflqrff
    kfsrdvylpkpswgnhtpifrdaglqlqayryydpktcsldftgamediskipeksiill
    hacahnptgvdprqeqwkelasvvkkrnllayfdmayqgfasgdinrdawalrhfieqgi
    dvvlsqsyahnmglygeragaftvicrdaeeakrvesqlkilirpmysnppmngariasl
    ilntpelrkewlvevkgmadriismrtqlvsnlkkegsshnwqhitdqigmfcftglkpe
    qverltkefsiymtkdgrisvagvassnvgylahaihqvtk