PDB entry 1ak9

View 1ak9 on RCSB PDB site
Description: subtilisin mutant 8321
Class: serine protease
Keywords: hydrolase, serine protease, sporulation
Deposited on 1997-05-30, released 1997-11-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-11-24, with a file datestamp of 2009-11-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.148
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: subtilisin 8321
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00782 (0-274)
      • engineered (21)
      • engineered (49)
      • engineered (86)
      • engineered (168)
      • engineered (216-217)
    Domains in SCOPe 2.08: d1ak9a_
  • Heterogens: CA, NA, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ak9A (A:)
    aqsvpygvsqikapalhsqgycgsnvkvavidsgidsshpdlkvaggasfvpsetnpfqd
    nnshgthvagtvaalnnsigvlgvapcaslyavkvlgadgsgqyswiingiewaiannmd
    vinmslggpsgsaalkaavdkavasgvvvvaaagnegtsgssstvgypakypsviavgav
    dssnqrasfssvgpeldvmapgvsiqstlpgnkygaksgtsmasphvagaaalilskhpn
    wtntqvrsslentttklgdsfyygkglinvqaaaq