PDB entry 1ak8

View 1ak8 on RCSB PDB site
Description: nmr solution structure of cerium-loaded calmodulin amino-terminal domain (ce2-tr1c), 23 structures
Deposited on 1997-05-29, released 1997-09-17
The last revision prior to the SCOP 1.71 freeze date was dated 1999-09-01, with a file datestamp of 1999-08-31.
Experiment type: NMR23
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1ak8__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ak8_ (-)
    madqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadg
    ngtidfpefltmmark