PDB entry 1ak8

View 1ak8 on RCSB PDB site
Description: nmr solution structure of cerium-loaded calmodulin amino-terminal domain (ce2-tr1c), 23 structures
Class: calcium-binding protein
Keywords: cerium-loaded, calcium-binding protein
Deposited on 1997-05-29, released 1997-09-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: calmodulin
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62157 (1-75)
  Domains in SCOPe 2.08: d1ak8a_
• Heterogens: CE

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ak8A (A:)
  madqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadg
  ngtidfpefltmmark