PDB entry 1ak6

View 1ak6 on RCSB PDB site
Description: destrin, nmr, minimized average structure
Class: actin-binding protein
Keywords: actin depolymerization factor, actin-binding protein
Deposited on 1997-05-29, released 1997-11-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: destrin
    Species: Homo sapiens, Sus scrofa [TaxId:9606,9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ak6a1, d1ak6a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ak6A (A:)
tmitpssgnsasgvqvadevcrifydmkvrkcstpeeikkrkkavifclsadkkciivee
gkeilvgdvgvtitdpfkhfvgmlpekdcryalydasfetkesrkeelmfflwapelapl
kskmiyasskdaikkkfqgikhecqangpedlnraciaeklggslivafegcpv