PDB entry 1ak5

View 1ak5 on RCSB PDB site
Description: inosine monophosphate dehydrogenase (impdh) from tritrichomonas foetus
Class: oxidoreductase
Keywords: dehydrogenase, alpha-8-beta-8 barrel, tim barrel, purine metabolism, oxidoreductase, tetramer, c4-tetramer
Deposited on 1997-05-28, released 1997-09-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.218
AEROSPACI score: -1.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inosine-5'-monophosphate dehydrogenase
    Species: Tritrichomonas foetus [TaxId:5724]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ak5a1
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ak5A (A:)
    makyynepchtfneyllipglstvdcipsnvnlstplvkfqkgqqseinlkiplvsaimq
    svsgekmaialareggisfifgsqsiesqaamvhavknfkagfvvsdsnvkpdqtfadvl
    aisqrtthntvavtddgtphgvllglvtqrdypidltqtetkvsdmmtpfsklvtahqdt
    klseankiiwekklnalpiidddqhlryivfrkdydrsqvchnelvdsqkrylvgagint
    rdfrervpalveagadvlcidssdgfsewqkitigwirekygdkvkvgagnivdgegfry
    ladagadfikigigggsicitreqkgigrgqatavidvvaernkyfeetgiyipvcsdgg
    ivydyhmtlalamgadfimlgryfarfeesptrkvtingsvmkeywgegssrarnwqryd
    lggkqklsfeegvdsyvpyagklkdnveaslnkvkstmcncgaltipqlqskakitlvss
    vsiveggahdvivkdrindyhpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ak5A (A:)
    akyynepchtfneyllipglstvdcipsnvnlstplvkfqkgqqseinlkiplvsaimqs
    vsgekmaialareggisfifgsqsiesqaamvhavknfkahnelvdsqkrylvgagintr
    dfrervpalveagadvlcidssdgfsewqkitigwirekygdkvkvgagnivdgegfryl
    adagadfikigigrgqatavidvvaernkyfeetgiyipvcsdggivydyhmtlalamga
    dfimlgryfarfeesptrkvtingsvmkeywgegssrgvdsyvpyagklkdnveaslnkv
    kstmcncgaltipqlqskakitlvssvsi