PDB entry 1ak2

View 1ak2 on RCSB PDB site
Description: adenylate kinase isoenzyme-2
Class: phosphotransferase
Keywords: nucleoside monophosphate kinase, phosphotransferase
Deposited on 1995-12-29, released 1996-06-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.222
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenylate kinase isoenzyme-2
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ak2a1, d1ak2a2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ak2A (A:)
    apnvpaaepvpespkgvravllgppgagkgtqapklaknfcvchlatgdmlramvasgse
    lgkklkatmdagklvsdemvlelieknletppckngflldgfprtvrqaemlddlmekrk
    ekldsviefsipdsllirritgrlihpqsgrsyheefnppkepmkdditgeplirrsddn
    kkalkirleayhtqttplveyyskrgihsaidasqtpdvvfasilaafskats
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ak2A (A:)
    pkgvravllgppgagkgtqapklaknfcvchlatgdmlramvasgselgkklkatmdagk
    lvsdemvlelieknletppckngflldgfprtvrqaemlddlmekrkekldsviefsipd
    sllirritgrlihpqsgrsyheefnppkepmkdditgeplirrsddnkkalkirleayht
    qttplveyyskrgihsaidasqtpdvvfasilaafskats