PDB entry 1ajz

View 1ajz on RCSB PDB site
Description: structure of dihydropteroate pyrophosphorylase
Deposited on 1997-05-13, released 1998-05-13
The last revision prior to the SCOP 1.55 freeze date was dated 1998-05-13, with a file datestamp of 1998-05-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.185
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1ajz__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ajz_ (-)
    mklfaqgtsldlshphvmgilnvtpdsfsdggthnslidavkhanlminagatiidvgge
    strpgaaevsveeelqrvipvveaiaqrfevwisvdtskpeviresakvgahiindirsl
    sepgaleaaaetglpvclmhmqgnpktmqeapkyddvfaevnryfieqiarceqagiake
    kllldpgfgfgknlshnysllarlaefhhfnlpllvgmsrksmigqllnvgpserlsgsl
    acaviaamqgahiirvhdvketveamrvveatlsakenkrye