PDB entry 1ajw

View 1ajw on RCSB PDB site
Description: structure of rhogdi: a c-terminal binding domain targets an n-terminal inhibitory peptide to gtpases, nmr, 20 structures
Class: rho-gtpase inhibitor
Keywords: rho-gtpase inhibitor, nucleotide exchange, isoprene binding
Deposited on 1997-05-11, released 1997-11-19
The last revision prior to the SCOP 1.73 freeze date was dated 1997-11-19, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: rhogdi
  Species: BOS TAURUS
  Gene: RHO
  Database cross-references and differences (RAF-indexed):
  • Uniprot P19803 (0-144)
  Domains in SCOP 1.73: d1ajwa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ajwA (A:)
  avsadpnvpnvvvtrltlvcstapgpleldltgdlesfkkqsfvlkegveyrikisfrvn
  reivsgmkyiqhtyrkgvkidktdymvgsygpraeeyefltpmeeapkgmlargsyniks
  rftdddrtdhlswewnltikkewkd