PDB entry 1ajw

View 1ajw on RCSB PDB site
Description: structure of rhogdi: a c-terminal binding domain targets an n-terminal inhibitory peptide to gtpases, nmr, 20 structures
Class: rho-gtpase inhibitor
Keywords: rho-gtpase inhibitor, nucleotide exchange, isoprene binding
Deposited on 1997-05-11, released 1997-11-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rhogdi
    Species: Bos taurus [TaxId:9913]
    Gene: RHO
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ajwa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ajwA (A:)
avsadpnvpnvvvtrltlvcstapgpleldltgdlesfkkqsfvlkegveyrikisfrvn
reivsgmkyiqhtyrkgvkidktdymvgsygpraeeyefltpmeeapkgmlargsyniks
rftdddrtdhlswewnltikkewkd