PDB entry 1ajp

View 1ajp on RCSB PDB site
Description: penicillin acylase complexed with 2,5-dihydroxyphenylacetic acid
Class: antibiotic resistance
Keywords: antibiotic resistance, ligand induced conformational change, hydrolase
Deposited on 1997-05-07, released 1997-11-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-12-12, with a file datestamp of 2012-12-07.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: 0.146
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: penicillin amidohydrolase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ajp.1
  • Chain 'B':
    Compound: penicillin amidohydrolase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06875 (0-556)
      • conflict (164)
    Domains in SCOPe 2.07: d1ajp.1
  • Heterogens: CA, OMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ajpA (A:)
    eqssseikivrdeygmphiyandtwhlfygygyvvaqdrlfqmemarrstqgtvaevlgk
    dfvkfdkdirrnywpdairaqiaalspedmsilqgyadgmnawidkvntnpetllpkqfn
    tfgftpkrwepfdvamifvgtmanrfsdstseidnlalltalkdkygvsqgmavfnqlkw
    lvnpsapttiavqesnyplkfnqqnsqta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ajpA (A:)
    ssseikivrdeygmphiyandtwhlfygygyvvaqdrlfqmemarrstqgtvaevlgkdf
    vkfdkdirrnywpdairaqiaalspedmsilqgyadgmnawidkvntnpetllpkqfntf
    gftpkrwepfdvamifvgtmanrfsdstseidnlalltalkdkygvsqgmavfnqlkwlv
    npsapttiavqesnyplkfnqqnsqt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ajpB (B:)
    snmwvigkskaqdakaimvngpqfgwyapaytygiglhgagydvtgntpfaypglvfghn
    gviswgstagfgddvdifaerlsaekpgyylhngkwvkmlsreetitvkngqaetftvwr
    tvhgnilqtdqttqtayaksrawdgkevasllawthqmkaknwqqwtqqaakqaltinwy
    yadvngnigyvhtgaypdrqsghdprlpvpgtgkwdwkgllpfemnpkvynpqsgyianw
    nnspqkdypasdlfaflwggadrvteidrlleqkprltadqawdvirqtsrqdlnlrlfl
    ptlqaatsgltqsdprrqlvetltrwdginllnddgktwqqpgsailnvwltsmlkrtvv
    aavpmpfdkwysasgyettqdgptgslnisvgakilyeavqgdkspipqavdlfagkpqq
    evvlaaledtwetlskrygnnvsnwktpamaltfrannffgvpqaaaeetrhqaeyqnrg
    tendmivfspttsdrpvlawdvvapgqsgfiapdgtvdkhyedqlkmyenfgrkslwltk
    qdveahkesqevlhvqr