PDB entry 1ajk

View 1ajk on RCSB PDB site
Description: circularly permuted (1-3,1-4)-beta-d-glucan 4-glucanohydrolase cpa16m-84
Deposited on 1997-05-06, released 1998-05-06
The last revision prior to the SCOP 1.55 freeze date was dated 1998-05-06, with a file datestamp of 1998-05-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.168
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1ajka_
  • Chain 'B':
    Domains in SCOP 1.55: d1ajkb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ajkA (A:)
    ntgivssfftytgpahgtqwdeidieflgkdttkvqfnyytngvgghekvislgfdaskg
    fhtyafdwqpgyikwyvdgvlkhtatanipstpgkimmnlwngtgvddwlgsynganply
    aeydwvkytsnqtggsffepfnsynsgtwekadgysnggvfnctwrannvnftndgklkl
    gltssaynkfdcaeyrstniygyglyevsmkpak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ajkA (A:)
    ntgivssfftytgpahgtqwdeidieflgkdttkvqfnyytngvgghekvislgfdaskg
    fhtyafdwqpgyikwyvdgvlkhtatanipstpgkimmnlwngtddwlgsynganplyae
    ydwvkytsnqtggsffepfnsynsgtwekadgysnggvfnctwrannvnftndgklklgl
    tssaynkfdcaeyrstniygyglyevsmkpak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ajkB (B:)
    ntgivssfftytgpahgtqwdeidieflgkdttkvqfnyytngvgghekvislgfdaskg
    fhtyafdwqpgyikwyvdgvlkhtatanipstpgkimmnlwngtgvddwlgsynganply
    aeydwvkytsnqtggsffepfnsynsgtwekadgysnggvfnctwrannvnftndgklkl
    gltssaynkfdcaeyrstniygyglyevsmkpak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ajkB (B:)
    ntgivssfftytgpahgtqwdeidieflgkdttkvqfnyytngvgghekvislgfdaskg
    fhtyafdwqpgyikwyvdgvlkhtatanipstpgkimmnlwngtplyaeydwvkytsnqt
    ggsffepfnsynsgtwekadgysnggvfnctwrannvnftndgklklgltssaynkfdca
    eyrstniygyglyevsmkpak