PDB entry 1ajk

View 1ajk on RCSB PDB site
Description: circularly permuted (1-3,1-4)-beta-d-glucan 4-glucanohydrolase cpa16m-84
Class: hydrolase
Keywords: hydrolase, glucanase, circular permutation
Deposited on 1997-05-06, released 1998-05-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.168
AEROSPACI score: -3.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: circularly permuted (1-3,1-4)-beta-d-glucan 4-glucanohydrolase
    Species: Paenibacillus macerans [TaxId:44252]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ajka_
  • Chain 'B':
    Compound: circularly permuted (1-3,1-4)-beta-d-glucan 4-glucanohydrolase
    Species: Paenibacillus macerans [TaxId:44252]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ajkb_
  • Heterogens: CA, PO4, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ajkA (A:)
    ntgivssfftytgpahgtqwdeidieflgkdttkvqfnyytngvgghekvislgfdaskg
    fhtyafdwqpgyikwyvdgvlkhtatanipstpgkimmnlwngtgvddwlgsynganply
    aeydwvkytsnqtggsffepfnsynsgtwekadgysnggvfnctwrannvnftndgklkl
    gltssaynkfdcaeyrstniygyglyevsmkpak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ajkA (A:)
    ntgivssfftytgpahgtqwdeidieflgkdttkvqfnyytngvgghekvislgfdaskg
    fhtyafdwqpgyikwyvdgvlkhtatanipstpgkimmnlwngtddwlgsynganplyae
    ydwvkytsnqtggsffepfnsynsgtwekadgysnggvfnctwrannvnftndgklklgl
    tssaynkfdcaeyrstniygyglyevsmkpak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ajkB (B:)
    ntgivssfftytgpahgtqwdeidieflgkdttkvqfnyytngvgghekvislgfdaskg
    fhtyafdwqpgyikwyvdgvlkhtatanipstpgkimmnlwngtgvddwlgsynganply
    aeydwvkytsnqtggsffepfnsynsgtwekadgysnggvfnctwrannvnftndgklkl
    gltssaynkfdcaeyrstniygyglyevsmkpak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ajkB (B:)
    ntgivssfftytgpahgtqwdeidieflgkdttkvqfnyytngvgghekvislgfdaskg
    fhtyafdwqpgyikwyvdgvlkhtatanipstpgkimmnlwngtplyaeydwvkytsnqt
    ggsffepfnsynsgtwekadgysnggvfnctwrannvnftndgklklgltssaynkfdca
    eyrstniygyglyevsmkpak