PDB entry 1ajh

View 1ajh on RCSB PDB site
Description: photoproduct of carbonmonoxy myoglobin at 40 k
Class: oxygen transport
Keywords: oxygen transport, respiratory protein, heme, photoproduct intermediate
Deposited on 1997-05-02, released 1997-11-12
The last revision prior to the SCOP 1.75 freeze date was dated 1997-11-12, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: 0.171
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myoglobin
  Species: Physeter catodon
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02185 (0-152)
  Domains in SCOP 1.75: d1ajha_
• Heterogens: SO4, HEM, CMO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ajhA (A:)
  vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
  lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
  gdfgadaqgamnkalelfrkdiaakykelgyqg