PDB entry 1aje

View 1aje on RCSB PDB site
Description: cdc42 from human, nmr, 20 structures
Class: g-protein
Keywords: g-protein, cellular signaling, cytoskeletal rearrangement
Deposited on 1997-05-02, released 1997-11-12
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cdc42hs
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1ajea_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ajeA (A:)
    gskiisamqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytl
    glfdtagqedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllv
    gtqidlrddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeai
    laaleppepkksrr