PDB entry 1aj8

View 1aj8 on RCSB PDB site
Description: citrate synthase from pyrococcus furiosus
Class: lyase
Keywords: hyperthermostable, lyase
Deposited on 1997-05-16, released 1997-11-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.191
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: citrate synthase
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1aj8a_
  • Chain 'B':
    Compound: citrate synthase
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1aj8b_
  • Heterogens: COA, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aj8A (A:)
    lakgledvyidqtnicyidgkegklyyrgysveelaelstfeevvyllwwgklpslsele
    nfkkelaksrglpkevieimealpknthpmgalrtiisylgniddsgdipvtpeevyrig
    isvtakiptivanwyrikngleyvppkeklshaanflymlhgeeppkewekamdvalily
    aeheinastlavmtvgstlsdyysailagigalkgpihggaveeaikqfmeigspekvee
    wffkalqqkrkimgaghrvyktydprarifkkyasklgdkklfeiaerlerlveeylskk
    gisinvdywsglvfygmkipielyttifamgriagwtahlaeyvshnriirprlqyvgei
    gkkylpielrr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1aj8B (B:)
    lakgledvyidqtnicyidgkegklyyrgysveelaelstfeevvyllwwgklpslsele
    nfkkelaksrglpkevieimealpknthpmgalrtiisylgniddsgdipvtpeevyrig
    isvtakiptivanwyrikngleyvppkeklshaanflymlhgeeppkewekamdvalily
    aeheinastlavmtvgstlsdyysailagigalkgpihggaveeaikqfmeigspekvee
    wffkalqqkrkimgaghrvyktydprarifkkyasklgdkklfeiaerlerlveeylskk
    gisinvdywsglvfygmkipielyttifamgriagwtahlaeyvshnriirprlqyvgei
    gkkylpielrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aj8B (B:)
    lakgledvyidqtnicyidgkegklyyrgysveelaelstfeevvyllwwgklpslsele
    nfkkelaksrglpkevieimealpknthpmgalrtiisylgniddsgdipvtpeevyrig
    isvtakiptivanwyrikngleyvppkeklshaanflymlhgeeppkewekamdvalily
    aeheinastlavmtvgstlsdyysailagigalkgpihggaveeaikqfmeigspekvee
    wffkalqqkrkimgaghrvyktydprarifkkyasklgdkklfeiaerlerlveeylskk
    gisinvdywsglvfygmkipielyttifamgriagwtahlaeyvshnriirprlqyvgei
    gkkylpielr