PDB entry 1aj7

View 1aj7 on RCSB PDB site
Description:
Deposited on 1997-05-15, released 1997-11-12
The last revision prior to the SCOP 1.69 freeze date was dated 1997-11-12, with a file datestamp of 1997-11-12.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.217
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1aj7h1, d1aj7h2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1aj7l1, d1aj7l2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aj7H (H:)
    qvqlqqsgaelvkpgasvklsctasgfnikdtymhwvkqrpeqglewigridpangntky
    dpkfqgkatitadtssntaylqlssltsedtavyycasyygiywgqgttltvssastkgp
    svfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
    svvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aj7L (L:)
    diqmtqspsslsaslgervsltcrasqeisgylswlqqkpdgtikrliyaastldsgvpk
    rfsgsrsgsdysltisslesedfadyyclqyasyprtfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec