PDB entry 1aj5

View 1aj5 on RCSB PDB site
Description: calpain domain vi apo
Class: calcium-binding protein
Keywords: calcium-binding protein, calcium-dependent protease, apo form, small subunit
Deposited on 1997-05-15, released 1998-05-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-02, with a file datestamp of 2012-04-27.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.22
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calpain
    Species: Rattus norvegicus [TaxId:10116]
    Gene: CAPN4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1aj5a_
  • Chain 'B':
    Compound: calpain
    Species: Rattus norvegicus [TaxId:10116]
    Gene: CAPN4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1aj5b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aj5A (A:)
    eeerqfrklfvqlagddmevsatelmnilnkvvtrhpdlktdgfgidtcrsmvavmdsdt
    tgklgfeefkylwnnikkwqgiykrfdtdrsgtigsnelpgafeaagfhlnqhiysmiir
    rysdetgnmdfdnfisclvrldamfrafrsldkngtgqiqvniqewlqltmys
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aj5B (B:)
    eeerqfrklfvqlagddmevsatelmnilnkvvtrhpdlktdgfgidtcrsmvavmdsdt
    tgklgfeefkylwnnikkwqgiykrfdtdrsgtigsnelpgafeaagfhlnqhiysmiir
    rysdetgnmdfdnfisclvrldamfrafrsldkngtgqiqvniqewlqltmys