PDB entry 1aj3

View 1aj3 on RCSB PDB site
Description: solution structure of the spectrin repeat, nmr, 20 structures
Class: cytoskeleton
Keywords: elasticity, membrane skeleton, spectrin, coiled-coil, cytoskeleton, calmodulin-binding, actin-binding, capping protein, calcium-binding, duplication, repeat, sh3 domain
Deposited on 1997-05-14, released 1997-07-07
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha spectrin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1aj3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1aj3A (A:)
    aklneshrlhqffrdmddeeswikekkllvssedygrdltgvqnlrkkhkrleaelaahe
    paiqgvldtgkklsddntigkeeiqqrlaqfvdhwkelkqlaaargqrle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aj3A (A:)
    hqffrdmddeeswikekkllvssedygrdltgvqnlrkkhkrleaelaahepaiqgvldt
    gkklsddntigkeeiqqrlaqfvdhwkelkqlaaargq