PDB entry 1aj3

View 1aj3 on RCSB PDB site
Description: solution structure of the spectrin repeat, nmr, 20 structures
Deposited on 1997-05-14, released 1997-07-07
The last revision prior to the SCOP 1.61 freeze date was dated 1997-07-07, with a file datestamp of 1997-07-08.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.61: d1aj3__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aj3_ (-)
    hqffrdmddeeswikekkllvssedygrdltgvqnlrkkhkrleaelaahepaiqgvldt
    gkklsddntigkeeiqqrlaqfvdhwkelkqlaaargq