PDB entry 1aj0

View 1aj0 on RCSB PDB site
Description: crystal structure of a ternary complex of e. coli dihydropteroate synthase
Deposited on 1997-05-14, released 1998-05-20
The last revision prior to the SCOP 1.55 freeze date was dated 1998-05-20, with a file datestamp of 1998-05-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.206
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1aj0__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aj0_ (-)
    mklfaqgtsldlshphvmgilnvtpdsfsdggthnslidavkhanlminagatiidvgge
    strpgaaevsveeelqrvipvveaiaqrfevwisvdtskpeviresakvgahiindirsl
    sepgaleaaaetglpvclmhmqgnpktmqeapkyddvfaevnryfieqiarceqagiake
    kllldpgfgfgknlshnysllarlaefhhfnlpllvgmsrksmigqllnvgpserlsgsl
    acaviaamqgahiirvhdvketveamrvveatlsakenkrye