PDB entry 1aiz

View 1aiz on RCSB PDB site
Description: structure of apo-azurin from alcaligenes denitrificans at 1.8 angstroms resolution
Class: electron transport(cadmium binding)
Keywords: electron transport(cadmium binding)
Deposited on 1993-11-11, released 1994-01-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.168
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Azurin
    Species: Achromobacter denitrificans [TaxId:32002]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1aiza_
  • Chain 'B':
    Compound: Azurin
    Species: Achromobacter denitrificans [TaxId:32002]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1aizb_
  • Heterogens: CD, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aizA (A:)
    aqceatiesndamqynlkemvvdksckqftvhlkhvgkmakvamghnwvltkeadkqgva
    tdgmnaglaqdyvkagdtrviahtkvigggesdsvtfdvskltpgeayayfcsfpghwam
    mkgtlklsn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aizB (B:)
    aqceatiesndamqynlkemvvdksckqftvhlkhvgkmakvamghnwvltkeadkqgva
    tdgmnaglaqdyvkagdtrviahtkvigggesdsvtfdvskltpgeayayfcsfpghwam
    mkgtlklsn