PDB entry 1aiw

View 1aiw on RCSB PDB site
Description: nmr structures of the cellulose-binding domain of the endoglucanase z from erwinia chrysanthemi, 23 structures
Deposited on 1997-04-30, released 1998-05-06
The last revision prior to the SCOP 1.55 freeze date was dated 1998-05-06, with a file datestamp of 1998-05-06.
Experiment type: NMR23
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1aiw__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aiw_ (-)
    mgdcananvypnwvskdwaggqpthneagqsivykgnlytanwytasvpgsdsswtqvgs
    cn