PDB entry 1aiw

View 1aiw on RCSB PDB site
Description: nmr structures of the cellulose-binding domain of the endoglucanase z from erwinia chrysanthemi, 23 structures
Class: cellulose degradation
Keywords: cellulose degradation, endoglucanase, cellulose-binding domain, erwinia chrysanthemi
Deposited on 1997-04-30, released 1998-05-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoglucanase z
    Species: Erwinia chrysanthemi [TaxId:198628]
    Gene: CELZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1aiwa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1aiwA (A:)
mgdcananvypnwvskdwaggqpthneagqsivykgnlytanwytasvpgsdsswtqvgs
cn