PDB entry 1aiv

View 1aiv on RCSB PDB site
Description: apo ovotransferrin
Class: iron transport protein
Keywords: iron transport protein
Deposited on 1997-04-28, released 1998-04-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.231
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ovotransferrin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1aiva1, d1aiva2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aivA (A:)
    appksvirwctisspeekkcnnlrdltqqerisltcvqkatyldcikaianneadaisld
    ggqafeaglapyklkpiaaevyehtegsttsyyavavvkkgteftvndlqgktschtglg
    rsagwnipigtllhrgaiewegiesgsveqavakffsascvpgatieqklcrqckgdpkt
    kcarnapysgysgafhclkdgkgdvafvkhttvnenapdqkdeyellcldgsrqpvdnyk
    tcnwarvaahavvarddnkvediwsflskaqsdfgvdtksdfhlfgppgkkdpvlkdllf
    kdsaimlkrvpslmdsqlylgfeyysaiqsmrkdqltpsprenriqwcavgkdekskcdr
    wsvvsngdvectvvdetkdciikimkgeadavaldgglvytagvcglvpvmaeryddesq
    csktderpasyfavavarkdsnvnwnnlkgkkschtavgrtagwvipmglihnrtgtcnf
    deyfsegcapgsppnsrlcqlcqgsggippekcvasshekyfgytgalrclvekgdvafi
    qhstveentggknkadwaknlqmddfellctdgrranvmdyrecnlaevpthavvvrpek
    ankirdllerqekrfgvngsekskfmmfesqnkdllfkdltkclfkvregttykeflgdk
    fytvisslktcnpsdilqmcsflegk