PDB entry 1ais

View 1ais on RCSB PDB site
Description: tata-binding protein/transcription factor (ii)b/tata-box complex from pyrococcus woesei
Deposited on 1997-04-24, released 1997-07-07
The last revision prior to the SCOP 1.55 freeze date was dated 1997-07-07, with a file datestamp of 1997-07-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.212
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aisA (A:)
    mvdmskvklrienivasvdlfaqldlekvldlcpnskynpeefpgiichlddpkvallif
    ssgklvvtgaksvqdieravaklaqklksigvkfkrapqidvqnmvfsgdigrefnldvv
    altlpnceyepeqfpgviyrvkepksvillfssgkivcsgakseadaweavrkllreldk
    y
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aisB (B:)
    nlafalseldritaqlklprhveeeaarlyreavrkglirgrsiesvmaacvyaacrllk
    vprtldeiadiarvdkkeigrsyrfiarnlnltpkklfvkptdyvnkfadelglsekvrr
    raieildeaykrgltsgkspaglvaaalyiasllegekrtqrevaevarvtevtvrnryk
    elveklkikvpia