PDB entry 1ais

View 1ais on RCSB PDB site
Description: tata-binding protein/transcription factor (II)b/tata-box complex from pyrococcus woesei
Class: transcription/DNA
Keywords: transcription, hyperthermophile, ribosome binding, complex (ribosome binding/ DNA), transcription/DNA complex
Deposited on 1997-04-24, released 1997-07-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.212
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (tata-binding protein)
    Species: Pyrococcus woesei [TaxId:2262]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1aisa1, d1aisa2
  • Chain 'B':
    Compound: protein (transcription initiation factor iib)
    Species: Pyrococcus woesei [TaxId:2262]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1aisb1, d1aisb2
  • Chain 'C':
    Compound: DNA (5'-d(*ap*ap*cp*tp*tp*ap*cp*tp*tp*tp*(5iu)p*(5iu)p*ap*ap*ap*gp*c)-3')
  • Chain 'E':
    Compound: DNA (5'-d(*gp*cp*tp*tp*tp*ap*ap*ap*ap*ap*gp*tp*ap*ap*gp*tp*t )-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1aisA (A:)
    mvdmskvklrienivasvdlfaqldlekvldlcpnskynpeefpgiichlddpkvallif
    ssgklvvtgaksvqdieravaklaqklksigvkfkrapqidvqnmvfsgdigrefnldvv
    altlpnceyepeqfpgviyrvkepksvillfssgkivcsgakseadaweavrkllreldk
    yl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aisA (A:)
    mvdmskvklrienivasvdlfaqldlekvldlcpnskynpeefpgiichlddpkvallif
    ssgklvvtgaksvqdieravaklaqklksigvkfkrapqidvqnmvfsgdigrefnldvv
    altlpnceyepeqfpgviyrvkepksvillfssgkivcsgakseadaweavrkllreldk
    y
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1aisB (B:)
    vsdaaernlafalseldritaqlklprhveeeaarlyreavrkglirgrsiesvmaacvy
    aacrllkvprtldeiadiarvdkkeigrsyrfiarnlnltpkklfvkptdyvnkfadelg
    lsekvrrraieildeaykrgltsgkspaglvaaalyiasllegekrtqrevaevarvtev
    tvrnrykelveklkikvpia
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aisB (B:)
    nlafalseldritaqlklprhveeeaarlyreavrkglirgrsiesvmaacvyaacrllk
    vprtldeiadiarvdkkeigrsyrfiarnlnltpkklfvkptdyvnkfadelglsekvrr
    raieildeaykrgltsgkspaglvaaalyiasllegekrtqrevaevarvtevtvrnryk
    elveklkikvpia
    

  • Chain 'C':
    No sequence available.

  • Chain 'E':
    No sequence available.