PDB entry 1air

View 1air on RCSB PDB site
Description: pectate lyase c from erwinia chrysanthemi (ec16) to a resolution of 2.2 angstroms with 128 waters
Class: pectate cleavage
Keywords: pectate cleavage, pectinolyitc activity, trans-elimination
Deposited on 1997-04-24, released 1997-06-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.172
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pectate lyase c
    Species: Erwinia chrysanthemi [TaxId:556]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1aira_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1airA (A:)
    atdtggyaataggnvtgavsktatsmqdivniidaarldangkkvkggayplvitytgne
    dslinaaaanicgqwskdprgveikeftkgitiigangssanfgiwikkssdvvvqnmri
    gylpggakdgdmirvddspnvwvdhnelfaanhecdgtpdndttfesavdikgasntvtv
    synyihgvkkvgldgssssdtgrnityhhnyyndvnarlplqrgglvhaynnlytnitgs
    glnvrqngqaliennwfekainpvtsrydgknfgtwvlkgnnitkpadfstysitwtadt
    kpyvnadswtstgtfptvaynyspvsaqcvkdklpgyagvgknlatltstack
    

    Sequence, based on observed residues (ATOM records): (download)
    >1airA (A:)
    atdtggyaataggnvtgavsktatsmqdivniidaarldangkkvkggayplvitytgne
    dslinaaaanicgqwskdprgveikeftkgitiigangssanfgiwikkssdvvvqnmri
    gylpggakdgdmirvddspnvwvdhnelfaanhecdgtpdndttfesavdikgasntvtv
    synyihgvkkvgldgssssdtgrnityhhnyyndvnarlplqrgglvhaynnlytnitgs
    glnvrqngqaliennwfekainpvtsrydgknfgtwvlkgnnitkpadfstysitwtadt
    kpyvnadswtstgtfptvaynyspvsaqcvkdklpgyagvgknlatltstac