PDB entry 1aip

View 1aip on RCSB PDB site
Description: ef-tu ef-ts complex from thermus thermophilus
Class: complex of two elongation factors
Keywords: elongation factor, nucleotide exchange, GTP-binding, complex of two elongation factors
Deposited on 1997-04-22, released 1997-10-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.216
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: elongation factor tu
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60338 (Start-404)
      • conflict (34)
    Domains in SCOPe 2.06: d1aipa1, d1aipa2, d1aipa3
  • Chain 'B':
    Compound: elongation factor tu
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60338 (Start-404)
      • conflict (34)
    Domains in SCOPe 2.06: d1aipb1, d1aipb2, d1aipb3
  • Chain 'C':
    Compound: elongation factor ts
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1aipc1, d1aipc2
  • Chain 'D':
    Compound: elongation factor ts
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1aipd1, d1aipd2
  • Chain 'E':
    Compound: elongation factor tu
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60338 (Start-404)
      • conflict (34)
    Domains in SCOPe 2.06: d1aipe1, d1aipe2, d1aipe3
  • Chain 'F':
    Compound: elongation factor tu
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60338 (Start-404)
      • conflict (34)
    Domains in SCOPe 2.06: d1aipf1, d1aipf2, d1aipf3
  • Chain 'G':
    Compound: elongation factor ts
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1aipg1, d1aipg2
  • Chain 'H':
    Compound: elongation factor ts
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1aiph1, d1aiph2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1aipA (A:)
    akgefvrtkphvnvgtighvdhgkttltaaltyvtaaenpnvevkdygdidkapeerarg
    itintahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehi
    llarqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallale
    qmhrnpktrrgenewvdkiwelldaideyiptpvrdvdkpflmpvedvftitgrgtvatg
    riergkvkvgdeveivglapetrrtvvtgvemhrktlqegiagdnvgvllrgvsreever
    gqvlakpgsitphtkfeasvyvlkkeeggrhtgffsgyrpqfyfrttdvtgvvqlppgve
    mvmpgdnvtftvelikpvaleeglrfaireggrtvgagvvtkile
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aipA (A:)
    kphvnvgtighvdhgkttltaaltyvtaaenptahveyetakrhyshvdcpghadyiknm
    itgaaqmdgailvvsaadgpmpqtrehillarqvgvpyivvfmnkvdmvddpelldlvem
    evrdllnqyefpgdevpvirgsallaleqmhrnpktrrgenewvdkiwelldaideyipt
    pvrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrrtvvtgvem
    hrktlqegiagdnvgvllrgvsreevergqvlakpgsitphtkfeasvyvlkkeeggrht
    gffsgyrpqfyfrttdvtgvvqlppgvemvmpgdnvtftvelikpvaleeglrfairegg
    rtvgagvvtkile
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1aipB (B:)
    akgefvrtkphvnvgtighvdhgkttltaaltyvtaaenpnvevkdygdidkapeerarg
    itintahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehi
    llarqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallale
    qmhrnpktrrgenewvdkiwelldaideyiptpvrdvdkpflmpvedvftitgrgtvatg
    riergkvkvgdeveivglapetrrtvvtgvemhrktlqegiagdnvgvllrgvsreever
    gqvlakpgsitphtkfeasvyvlkkeeggrhtgffsgyrpqfyfrttdvtgvvqlppgve
    mvmpgdnvtftvelikpvaleeglrfaireggrtvgagvvtkile
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aipB (B:)
    kphvnvgtighvdhgkttltaaltyvtaaenptahveyetakrhyshvdcpghadyiknm
    itgaaqmdgailvvsaadgpmpqtrehillarqvgvpyivvfmnkvdmvddpelldlvem
    evrdllnqyefpgdevpvirgsallaleqmhrnpktrrgenewvdkiwelldaideyipt
    pvrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrrtvvtgvem
    hrktlqegiagdnvgvllrgvsreevergqvlakpgsitphtkfeasvyvlkkeeggrht
    gffsgyrpqfyfrttdvtgvvqlppgvemvmpgdnvtftvelikpvaleeglrfairegg
    rtvgagvvtkile
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1aipC (C:)
    msqmelikklreatgagmmdvkraledagwdeekavqllrergamkaakkadrearegii
    ghyihhnqrvgvlvelncetdfvarnelfqnlakdlamhiammnpryvsaeeipaeelek
    erqiyiqaalnegkpqqiaekiaegrlkkyleevvlleqpfvkddkvkvkeliqqaiaki
    genivvrrfcrfelga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aipC (C:)
    sqmelikklreatgagmmdvkraledagwdeekavqllrergamkaakkadrearegiig
    hyihhnqrvgvlvelncetdfvarnelfqnlakdlamhiammnpryvsaeeipaeeleke
    rqiyiqaalnegkpqqiaekiaegrlkkyleevvlleqpfvkddkvkvkeliqqaiakig
    enivvrrfcrfelga
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1aipD (D:)
    msqmelikklreatgagmmdvkraledagwdeekavqllrergamkaakkadrearegii
    ghyihhnqrvgvlvelncetdfvarnelfqnlakdlamhiammnpryvsaeeipaeelek
    erqiyiqaalnegkpqqiaekiaegrlkkyleevvlleqpfvkddkvkvkeliqqaiaki
    genivvrrfcrfelga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aipD (D:)
    sqmelikklreatgagmmdvkraledagwdeekavqllrergamkaakkadrearegiig
    hyihhnqrvgvlvelncetdfvarnelfqnlakdlamhiammnpryvsaeeipaeeleke
    rqiyiqaalnegkpqqiaekiaegrlkkyleevvlleqpfvkddkvkvkeliqqaiakig
    enivvrrfcrfelga
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1aipE (E:)
    akgefvrtkphvnvgtighvdhgkttltaaltyvtaaenpnvevkdygdidkapeerarg
    itintahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehi
    llarqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallale
    qmhrnpktrrgenewvdkiwelldaideyiptpvrdvdkpflmpvedvftitgrgtvatg
    riergkvkvgdeveivglapetrrtvvtgvemhrktlqegiagdnvgvllrgvsreever
    gqvlakpgsitphtkfeasvyvlkkeeggrhtgffsgyrpqfyfrttdvtgvvqlppgve
    mvmpgdnvtftvelikpvaleeglrfaireggrtvgagvvtkile
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aipE (E:)
    kphvnvgtighvdhgkttltaaltyvtaaenpahveyetakrhyshvdcpghadyiknmi
    tgaaqmdgailvvsaadgpmpqtrehillarqvgvpyivvfmnkvdmvddpelldlveme
    vrdllnqyefpgdevpvirgsallaleqmhrnpktrrgenewvdkiwelldaideyiptp
    vrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrrtvvtgvemh
    rktlqegiagdnvgvllrgvsreevergqvlakpgsitphtkfeasvyvlkkeeggrhtg
    ffsgyrpqfyfrttdvtgvvqlppgvemvmpgdnvtftvelikpvaleeglrfaireggr
    tvgagvvtkile
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1aipF (F:)
    akgefvrtkphvnvgtighvdhgkttltaaltyvtaaenpnvevkdygdidkapeerarg
    itintahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehi
    llarqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallale
    qmhrnpktrrgenewvdkiwelldaideyiptpvrdvdkpflmpvedvftitgrgtvatg
    riergkvkvgdeveivglapetrrtvvtgvemhrktlqegiagdnvgvllrgvsreever
    gqvlakpgsitphtkfeasvyvlkkeeggrhtgffsgyrpqfyfrttdvtgvvqlppgve
    mvmpgdnvtftvelikpvaleeglrfaireggrtvgagvvtkile
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aipF (F:)
    kphvnvgtighvdhgkttltaaltyvtaaenpahveyetakrhyshvdcpghadyiknmi
    tgaaqmdgailvvsaadgpmpqtrehillarqvgvpyivvfmnkvdmvddpelldlveme
    vrdllnqyefpgdevpvirgsallaleqmhrnpktrrgenewvdkiwelldaideyiptp
    vrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrrtvvtgvemh
    rktlqegiagdnvgvllrgvsreevergqvlakpgsitphtkfeasvyvlkkeeggrhtg
    ffsgyrpqfyfrttdvtgvvqlppgvemvmpgdnvtftvelikpvaleeglrfaireggr
    tvgagvvtkile
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1aipG (G:)
    msqmelikklreatgagmmdvkraledagwdeekavqllrergamkaakkadrearegii
    ghyihhnqrvgvlvelncetdfvarnelfqnlakdlamhiammnpryvsaeeipaeelek
    erqiyiqaalnegkpqqiaekiaegrlkkyleevvlleqpfvkddkvkvkeliqqaiaki
    genivvrrfcrfelga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aipG (G:)
    sqmelikklreatgagmmdvkraledagwdeekavqllrergamkaakkadrearegiig
    hyihhnqrvgvlvelncetdfvarnelfqnlakdlamhiammnpryvsaeeipaeeleke
    rqiyiqaalnegkpqqiaekiaegrlkkyleevvlleqpfvkddkvkvkeliqqaiakig
    enivvrrfcrfelga
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1aipH (H:)
    msqmelikklreatgagmmdvkraledagwdeekavqllrergamkaakkadrearegii
    ghyihhnqrvgvlvelncetdfvarnelfqnlakdlamhiammnpryvsaeeipaeelek
    erqiyiqaalnegkpqqiaekiaegrlkkyleevvlleqpfvkddkvkvkeliqqaiaki
    genivvrrfcrfelga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aipH (H:)
    qmelikklreatgagmmdvkraledagwdeekavqllrergamkaakkadrearegiigh
    yihhnqrvgvlvelncetdfvarnelfqnlakdlamhiammnpryvsaeeipaeeleker
    qiyiqaalnegkpqqiaekiaegrlkkyleevvlleqpfvkddkvkvkeliqqaiakige
    nivvrrfcrfelga