PDB entry 1aim

View 1aim on RCSB PDB site
Description: cruzain inhibited by benzoyl-tyrosine-alanine-fluoromethylketone
Class: hydrolase/hydrolase inhibitor
Keywords: cysteine protease, trypanosoma cruzi, fluoromethyl ketone, hydrolase-hydrolase inhibitor complex
Deposited on 1997-04-21, released 1997-10-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.188
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cruzain
  Species: Trypanosoma cruzi [TaxId:5693]
  Gene: rtp
  Database cross-references and differences (RAF-indexed):
  • Uniprot P25779 (0-214)
    • conflict (157)
  Domains in SCOPe 2.07: d1aima_
• Heterogens: ZYA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1aimA (A:)
  apaavdwrargavtavkdqgqcgscwafsaignvecqwflaghpltnlseqmlvscdktd
  sgcsgglmnnafewivqenngavytedsypyasgegisppcttsghtvgatitghvelpq
  deaqiaawlavngpvavavdasswmtytggvmtscvsealdhgvllvgyndsaavpywii
  knswttqwgeegyiriakgsnqclvkeeassavvg