PDB entry 1ail

View 1ail on RCSB PDB site
Description: n-terminal fragment of ns1 protein from influenza a virus
Class: RNA-binding protein
Keywords: RNA-binding protein, nonstructural protein
Deposited on 1997-04-21, released 1997-10-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.182
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nonstructural protein NS1
    Species: Influenza A virus (A/Udorn/307/1972(H3N2)) [TaxId:381517]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1aila_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1ailA (A:)
mdsntvssfqvdcflwhvrkqvvdqelgdapfldrlrrdqkslrgrgstlglnieaathv
gkqivekilkeed

    Sequence, based on observed residues (ATOM records): (download) 
    >1ailA (A:)
mdsntvssfqvdcflwhvrkqvvdqelgdapfldrlrrdqkslrgrgstlglnieaathv
gkqivekilk