PDB entry 1aik

View 1aik on RCSB PDB site
Description: hiv gp41 core structure
Deposited on 1997-04-20, released 1997-06-16
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.238
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'C':
  Compound: hiv-1 gp41 glycoprotein
  Species: HIV-1 M:B_HXB2R [TaxId:11706]
  Gene: GP41
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04578 (0-33)
• Chain 'N':
  Compound: hiv-1 gp41 glycoprotein
  Species: HIV-1 M:B_HXB2R [TaxId:11706]
  Gene: GP41
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04578 (0-35)
• Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOP 1.55, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'C':
  Sequence; same for both SEQRES and ATOM records:
  

  >1aikC (C:)
  wmewdreinnytslihslieesqnqqekneqell
  

  
  
• Chain 'N':
  Sequence; same for both SEQRES and ATOM records:
  

  >1aikN (N:)
  sgivqqqnnllraieaqqhllqltvwgikqlqaril