PDB entry 1aik

View 1aik on RCSB PDB site
Description: hiv gp41 core structure
Class: Viral protein
Keywords: HIV, GP41, ENVELOPE GLYCOPROTEIN, RETROVIRUS, Viral protein
Deposited on 1997-04-20, released 1997-06-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.238
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: hiv-1 gp41 glycoprotein
    Species: HIV-1 M:B_HXB2R [TaxId:11706]
    Gene: GP41
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1aik.1
  • Chain 'N':
    Compound: hiv-1 gp41 glycoprotein
    Species: HIV-1 M:B_HXB2R [TaxId:11706]
    Gene: GP41
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1aik.1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aikC (C:)
    wmewdreinnytslihslieesqnqqekneqell
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aikN (N:)
    sgivqqqnnllraieaqqhllqltvwgikqlqaril